| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytochrome b5 Outer Mitochondrial Membrane |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25144769). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytochrome b5 Outer Mitochondrial Membrane Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome b5 Outer Mitochondrial Membrane. This antibody reacts with human, mouse. The Cytochrome b5 Outer Mitochondrial Membrane Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cytochrome b5 Outer Mitochondrial Membrane antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
|---|
| Other Names | CYB5M, CYB5-M, CYPB5M, Cytochrome b5 outer mitochondrial membrane isoform, cytochrome b5 type B, cytochrome b5 type B (outer mitochondrial membrane), DKFZp686M0619, OMB5, outer mitochondrial membrane cytochrome b5, type 2 cyt-b5 |
|---|
| Gene, Accession # | CYB5B, Gene ID: 80777 |
|---|
| Catalog # | NBP1-88039 |
|---|
| Price | |
|---|
| Order / More Info | Cytochrome b5 Outer Mitochondrial Membrane Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22203676, 25144769 |
|---|
| 产品资料 |
|
|