| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytochrome b245 alpha |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytochrome b245 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome b245 alpha. This antibody reacts with human. The Cytochrome b245 alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to CYBA(cytochrome b-245, alpha polypeptide) The peptide sequence was selected from the middle region of CYBA. Peptide sequence TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP. |
| Other Names | cytochrome b light chain, Cytochrome b(558) alpha chain, cytochrome b(558) alpha-subunit, cytochrome b, alpha polypeptide, cytochrome b-245 light chain, cytochrome b-245, alpha polypeptide, Cytochrome b558 subunit alpha, flavocytochrome b-558 alpha polypeptide, Neutrophil cytochrome b 22 kDa polypeptide, p22 phagocyte B-cytochrome, p22phox, p22-phox, Superoxide-generating NADPH oxidase light chain subunit |
| Gene, Accession # | CYBA, Gene ID: 1535, Accession: P13498, SwissProt: P13498 |
| Catalog # | NBP1-59573 |
| Price | |
| Order / More Info | Cytochrome b245 alpha Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|