| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | INPP4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25277204). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The INPP4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to INPP4B. This antibody reacts with human. The INPP4B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human INPP4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ |
|---|
| Other Names | inositol polyphosphate-4-phosphatase, type II, 105kDa, type II inositol-3,4-bisphosphate 4-phosphatase |
|---|
| Gene, Accession # | INPP4B, Gene ID: 8821 |
|---|
| Catalog # | NBP1-85883 |
|---|
| Price | |
|---|
| Order / More Info | INPP4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25277204, 28982866 |
|---|
| 产品资料 |
|
|