| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | INPP5A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The INPP5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to INPP5A. This antibody reacts with human. The INPP5A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human INPP5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALG |
|---|
| Other Names | 43 kDa inositol polyphosphate 5-phophatase, CTCL tumor antigen HD-CL-02,5PTASE, DKFZp434A1721, EC 3.1.3.56, inositol polyphosphate-5-phosphatase, 40kD, inositol polyphosphate-5-phosphatase, 40kDa, inositol trisphosphate-5-phosphatase, 40kD, InsP3 5-phosphatase, MGC116947,5PTase, MGC116949, type I inositol-14,5-trisphosphate 5-phophatase, type I inositol-14,5-trisphosphate 5-phosphatase |
|---|
| Gene, Accession # | INPP5A, Gene ID: 3632 |
|---|
| Catalog # | NBP2-56659 |
|---|
| Price | |
|---|
| Order / More Info | INPP5A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|