| Edit |   |
| Antigenic Specificity | Inositol Monophosphatase 3/IMPAD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Inositol Monophosphatase 3/IMPAD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Inositol Monophosphatase 3/IMPAD1. This antibody reacts with human. The Inositol Monophosphatase 3/IMPAD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the middle region of IMPAD1. Peptide sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII. |
| Other Names | EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3 |
| Gene, Accession # | IMPAD1, Gene ID: 54928, Accession: Q9NX62, SwissProt: Q9NX62 |
| Catalog # | NBP1-59472 |
| Price | |
| Order / More Info | Inositol Monophosphatase 3/IMPAD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |