| Edit |   |
|---|
| Antigenic Specificity | Inositol Monophosphatase 3/IMPAD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Inositol Monophosphatase 3/IMPAD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Inositol Monophosphatase 3/IMPAD1. This antibody reacts with human. The Inositol Monophosphatase 3/IMPAD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the N terminal of IMPAD1. Peptide sequence VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL. |
|---|
| Other Names | EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3 |
|---|
| Gene, Accession # | IMPAD1, Gene ID: 54928, Accession: Q9NX62, SwissProt: Q9NX62 |
|---|
| Catalog # | NBP1-59473-20ul |
|---|
| Price | |
|---|
| Order / More Info | Inositol Monophosphatase 3/IMPAD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|