| 产品详情 |
| Edit |   |
| Antigenic Specificity | PRKCSH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRKCSH Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRKCSH. This antibody reacts with human. The PRKCSH Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PRKCSH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTC |
| Other Names | AGE-R2,80K-H protein, G19P1AGE-binding receptor 2, glucosidase 2 subunit beta, Glucosidase II subunit beta, glucosidase II, beta subunit, hepatocystin, PCLD, PKCSH, PLD1, Protein kinase C substrate 60.1 kDa protein heavy chain, protein kinase C substrate 80K-H, protein kinase C substrate, 80 Kda protein |
| Gene, Accession # | PRKCSH, Gene ID: 5589, Accession: P14314, SwissProt: P14314 |
| Catalog # | NBP2-38511 |
| Price | |
| Order / More Info | PRKCSH Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|