| Edit |   |
| Antigenic Specificity | IMPG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IMPG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IMPG1. This antibody reacts with human. The IMPG1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is IMPG1 - C-terminal region. Peptide sequence TKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLT. |
| Other Names | GP147, interphotoreceptor matrix proteoglycan 1, IPM150, SPACR |
| Gene, Accession # | IMPG1, Gene ID: 3617, Accession: NP_001554, SwissProt: NP_001554 |
| Catalog # | NBP1-98597 |
| Price | |
| Order / More Info | IMPG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |