| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PNPLA8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNPLA8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNPLA8. This antibody reacts with human. The PNPLA8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PNPLA8(patatin-like phospholipase domain containing 8) The peptide sequence was selected from the middle region of PNPLA8. Peptide sequence IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY. |
|---|
| Other Names | calcium-independent phospholipase A2-gamma, EC 3.1.1.5, Intracellular membrane-associated calcium-independent phospholipase A2 gamma, iPLA2 gamma, IPLA22, IPLA2-2, iPLA2-gamma, IPLA2GIPLA2(GAMMA), membrane-associated calcium-independent phospholipase A2 gamma, patatin-like phospholipase domain containing 8, Patatin-like phospholipase domain-containing protein 8, PNPLA-gamma |
|---|
| Gene, Accession # | PNPLA8, Gene ID: 50640, Accession: Q9NP80, SwissProt: Q9NP80 |
|---|
| Catalog # | NBP1-54326 |
|---|
| Price | |
|---|
| Order / More Info | PNPLA8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|