| Edit |   |
|---|
| Antigenic Specificity | PNPLA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNPLA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNPLA4. This antibody reacts with human. The PNPLA4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PNPLA4(patatin-like phospholipase domain containing 4) The peptide sequence was selected from the C terminal of PNPLA4. Peptide sequence SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM. |
|---|
| Other Names | calcium independent phospholipases A2 eta, DXS1283Epatatin-like phospholipase domain-containing protein 4, GS2EC 3.1.1.3, IPLA2 eta, patatin-like phospholipase domain containing 4, Protein GS2 |
|---|
| Gene, Accession # | PNPLA4, Gene ID: 8228, Accession: P41247, SwissProt: P41247 |
|---|
| Catalog # | NBP1-57925 |
|---|
| Price | |
|---|
| Order / More Info | PNPLA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|