| 产品详情 |
| Edit |   |
| Antigenic Specificity | IF3EI |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IF3EI Antibody from Novus Biologicals is a rabbit polyclonal antibody to IF3EI. This antibody reacts with human. The IF3EI Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: L |
| Immunogen | Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYER |
| Other Names | eIEF associated protein HSPC021, EIF3EIP, eIF3l, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein, eukaryotic translation initiation factor 3 subunit L, eukaryotic translation initiation factor 3, subunit 6 interacting protein, eukaryotic translation initiation factor 3, subunit L, HSPC021, HSPC025, MSTP005, subunit E interacting protein |
| Gene, Accession # | EIF3L, Gene ID: 51386, Accession: Q9Y262, SwissProt: Q9Y262 |
| Catalog # | NBP1-56926 |
| Price | |
| Order / More Info | IF3EI Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|