| Edit |   |
|---|
| Antigenic Specificity | IER5L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IER5L Antibody from Novus Biologicals is a rabbit polyclonal antibody to IER5L. This antibody reacts with human. The IER5L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human IER5LThe immunogen for this antibody is IER5L. Peptide sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA. |
|---|
| Other Names | bA247A12.2, immediate early response 5-like, immediate early response gene 5-like protein, MGC70833 |
|---|
| Gene, Accession # | IER5L, Gene ID: 389792, Accession: NP_982258, SwissProt: NP_982258 |
|---|
| Catalog # | NBP1-79610-20ul |
|---|
| Price | |
|---|
| Order / More Info | IER5L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|