| Edit |   |
| Antigenic Specificity | IER5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IER5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IER5. This antibody reacts with human. The IER5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IER5(immediate early response 5) The peptide sequence was selected from the N terminal of IER5. Peptide sequence MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD. |
| Other Names | immediate early response 5, immediate early response gene 5 protein, MGC102760, SBBI48 |
| Gene, Accession # | IER5, Gene ID: 51278, Accession: Q5VY09, SwissProt: Q5VY09 |
| Catalog # | NBP1-54809 |
| Price | |
| Order / More Info | IER5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |