| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WRCH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WRCH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WRCH1. This antibody reacts with human. The WRCH1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV. |
|---|
| Other Names | ARHU, CDC42L1GTP-binding protein-like 1, DJ646B12.2, fJ646B12.2, FLJ10616,2310026M05Rik, G28K, GTP-binding protein like 1, GTP-binding protein SB128, hG28K, ras homolog gene family, member U, ras-like gene family member U, Rho GTPase-like protein ARHU, rho-related GTP-binding protein RhoU, Ryu GTPase, Wnt-1 responsive Cdc42 homolog 1, WRCH-1, WRCH1CDC42-like GTPase 1 |
|---|
| Gene, Accession # | RHOU, Gene ID: 58480, Accession: Q7L0Q8, SwissProt: Q7L0Q8 |
|---|
| Catalog # | NBP1-58350 |
|---|
| Price | |
|---|
| Order / More Info | WRCH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|