| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Wnt-7b |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID25823570) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Wnt-7b Antibody from Novus Biologicals is a rabbit polyclonal antibody to Wnt-7b. This antibody reacts with human, mouse. The Wnt-7b Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. |
|---|
| Immunogen | Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM. |
|---|
| Other Names | protein Wnt-7b, wingless-type MMTV integration site family, member 7B |
|---|
| Gene, Accession # | WNT7B, Gene ID: 7477, Accession: P56706, SwissProt: P56706 |
|---|
| Catalog # | NBP1-59564 |
|---|
| Price | |
|---|
| Order / More Info | Wnt-7b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25361771, 25823570, 29871934 |
|---|
| 产品资料 |
|
|