| Edit |   |
| Antigenic Specificity | SOX1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, rabbit, human, mouse, bovine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SOX1 Antibody |
| Immunogen | The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the C terminal of human SOX1. Synthetic peptide located within the following region: ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA |
| Other Names | SRY (sex determining region Y)-box 1 |
| Gene, Accession # | SOX1, Accession: NM_005986 |
| Catalog # | TA335704 |
| Price | |
| Order / More Info | SOX1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |