| Edit |   |
| Antigenic Specificity | SOWAHD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SOWAHD Antibody |
| Immunogen | The immunogen for anti-SOWAHD antibody is: synthetic peptide directed towards the C-terminal region of Human SOWAHD. Synthetic peptide located within the following region: NLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSL |
| Other Names | ANKRD58, sosondowah ankyrin repeat domain family member D |
| Gene, Accession # | ANR58, Accession: NM_001105576 |
| Catalog # | TA334870 |
| Price | |
| Order / More Info | SOWAHD Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |