| Edit |   |
|---|
| Antigenic Specificity | KRT75 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-KRT75 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-KRT75 antibody: synthetic peptide directed towards the N terminal of human KRT75. Synthetic peptide located within the following region: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI |
|---|
| Other Names | K6HF, KB18, PFB, keratin 75 |
|---|
| Gene, Accession # | K2C75, Accession: NM_004693 |
|---|
| Catalog # | TA344210 |
|---|
| Price | |
|---|
| Order / More Info | KRT75 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|