| Edit |   |
| Antigenic Specificity | IFIT5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IFIT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFIT5. This antibody reacts with human. The IFIT5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the N terminal of IFIT5. Peptide sequence LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA. |
| Other Names | FLJ53857, IFIT-5, interferon-induced protein with tetratricopeptide repeats 5, Retinoic acid- and interferon-inducible 58 kDa protein, retinoic acid- and interferon-inducible protein (58kD), RI58FLJ92678 |
| Gene, Accession # | IFIT5, Gene ID: 24138, Accession: Q13325, SwissProt: Q13325 |
| Catalog # | NBP1-58886 |
| Price | |
| Order / More Info | IFIT5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |