| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IFIT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFIT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFIT3. This antibody reacts with human. The IFIT3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to IFIT3(interferon-induced protein with tetratricopeptide repeats 3) The peptide sequence was selected from the N terminal of IFIT3. Peptide sequence ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY. |
|---|
| Other Names | CIG-49, GARG-49, IFI60Retinoic acid-induced gene G protein, IFIT-3, IFIT-4, IFIT4IFI-60K, interferon-induced protein with tetratricopeptide repeats 3, Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein, IRG2, ISG60, ISG-60, RIG-GCIG49 |
|---|
| Gene, Accession # | IFIT3, Gene ID: 3437, Accession: O14879, SwissProt: O14879 |
|---|
| Catalog # | NBP1-56632 |
|---|
| Price | |
|---|
| Order / More Info | IFIT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|