Edit |   |
Antigenic Specificity | TMF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-TMF1 Antibody |
Immunogen | The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the middle region of human TMF1. Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ |
Other Names | ARA160, TMF, TATA element modulatory factor 1 |
Gene, Accession # | TMF1, Accession: NM_007114 |
Catalog # | TA330047 |
Price | |
Order / More Info | TMF1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |