| 产品详情 |
| Edit |   |
| Antigenic Specificity | TNS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. iCC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TNS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNS3. This antibody reacts with human. The TNS3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TNS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV |
| Other Names | TEM6, TENS1, Tensin 3, tensin-3, Tensin-Like SH2 Domain Containing 1, Tensin-Like SH2 Domain-Containing 1, Tensin-Like SH2 Domain-Containing Protein 1, Thyroid Specific PTB Domain Protein, TPP, Tumor Endothelial Marker 6 |
| Gene, Accession # | TNS3, Gene ID: 64759, Accession: Q68CZ2, SwissProt: Q68CZ2 |
| Catalog # | NBP2-37952 |
| Price | |
| Order / More Info | TNS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|