| Edit |   |
| Antigenic Specificity | TNRC6B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TNRC6B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNRC6B. This antibody reacts with human. The TNRC6B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TNRC6B(trinucleotide repeat containing 6B) The peptide sequence was selected from the N terminal of TNRC6B. Peptide sequence LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG. |
| Other Names | KIAA1093trinucleotide repeat-containing gene 6B protein, trinucleotide repeat containing 6B |
| Gene, Accession # | TNRC6B, Gene ID: 23112, Accession: B0QY73, SwissProt: B0QY73 |
| Catalog # | NBP1-57461 |
| Price | |
| Order / More Info | TNRC6B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |