| Edit |   |
| Antigenic Specificity | TNRC18B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TNRC18B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNRC18B. This antibody reacts with human. The TNRC18B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TNRC18. Peptide sequence GKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVER. |
| Other Names | TNRC18, TNRC18B, TNRC18P2 trinucleotide repeat containing 18 pseudogene 2 |
| Gene, Accession # | TNRC18, Gene ID: 27320, Accession: AAI31809, SwissProt: AAI31809 |
| Catalog # | NBP1-91426-20ul |
| Price | |
| Order / More Info | TNRC18B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |