| Edit |   |
|---|
| Antigenic Specificity | TNP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TNP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNP1. This antibody reacts with human. The TNP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to TNP1(transition protein 1 (during histone to protamine replacement)) The peptide sequence was selected from the N terminal of TNP1. Peptide sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN. |
|---|
| Other Names | spermatid nuclear transition protein 1, STP-1, TP1, TP-1, transition protein 1 (during histone to protamine replacement) |
|---|
| Gene, Accession # | TNP1, Gene ID: 7141, Accession: P09430, SwissProt: P09430 |
|---|
| Catalog # | NBP1-55356 |
|---|
| Price | |
|---|
| Order / More Info | TNP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|