Edit |   |
Antigenic Specificity | HERC4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-HERC4 Antibody |
Immunogen | The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4. Synthetic peptide located within the following region: LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL |
Other Names | HECT and RLD domain containing E3 ubiquitinprotein ligase 4 |
Gene, Accession # | HERC4, Accession: NM_022079 |
Catalog # | TA330458 |
Price | |
Order / More Info | HERC4 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |