| Edit |   |
| Antigenic Specificity | HERC4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-HERC4 antibody |
| Immunogen | The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4. Synthetic peptide located within the following region: VGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEILKVCQISRLYR |
| Other Names | HECT and RLD domain containing E3 ubiquitinprotein ligase 4 |
| Gene, Accession # | HERC4, Accession: NM_001017972 |
| Catalog # | TA329560 |
| Price | |
| Order / More Info | HERC4 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |