| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TNIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TNIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNIP2. This antibody reacts with human. The TNIP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TNIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRP |
|---|
| Other Names | A20-binding inhibitor of NF-kappa-B activation 2, A20-binding inhibitor of NF-kappaB activation-2, ABIN-2, ABIN2KLIP, Fetal liver LKB1-interacting protein, FLIP1DKFZp434J1313, MGC4289, TNFAIP3 interacting protein 2, TNFAIP3-interacting protein 2 |
|---|
| Gene, Accession # | TNIP2, Gene ID: 79155 |
|---|
| Catalog # | NBP2-48949 |
|---|
| Price | |
|---|
| Order / More Info | TNIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|