Edit |   |
Antigenic Specificity | DCDC2 - N-terminal region |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human; mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-DCDC2 Antibody - N-terminal region |
Immunogen | The immunogen for anti-Dcdc2a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS |
Other Names | DCDC2A, RU2, RU2S, doublecortin domain containing 2 |
Gene, Accession # | DCDC2, Accession: NM_016356 |
Catalog # | TA345033 |
Price | |
Order / More Info | DCDC2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |