| Edit |   |
| Antigenic Specificity | DCDC2 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human; mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-DCDC2 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-Dcdc2a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS |
| Other Names | DCDC2A, RU2, RU2S, doublecortin domain containing 2 |
| Gene, Accession # | DCDC2, Accession: NM_016356 |
| Catalog # | TA345033 |
| Price | |
| Order / More Info | DCDC2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |