| Edit |   |
|---|
| Antigenic Specificity | DCDC2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DCDC2B Antibody |
|---|
| Immunogen | The immunogen for Anti-DCDC2B Antibody is: synthetic peptide directed towards the C-terminal region of Human DCDC2B. Synthetic peptide located within the following region: ELLVPSPSLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSA |
|---|
| Other Names | doublecortin domain containing 2B |
|---|
| Gene, Accession # | DCD2B, Accession: NM_001099434 |
|---|
| Catalog # | TA335918 |
|---|
| Price | |
|---|
| Order / More Info | DCDC2B Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|