| Edit |   |
|---|
| Antigenic Specificity | DCDC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DCDC5 Antibody |
|---|
| Immunogen | The immunogen for Anti-DCDC5 Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC5. Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA |
|---|
| Other Names | doublecortin domain containing 5 |
|---|
| Gene, Accession # | DCDC5, Accession: NM_020869 |
|---|
| Catalog # | TA331810 |
|---|
| Price | |
|---|
| Order / More Info | DCDC5 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|