| Edit |   |
|---|
| Antigenic Specificity | DCAF4L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DCAF4L1 Antibody |
|---|
| Immunogen | The immunogen for anti-DCAF4L1 antibody: synthetic peptide directed towards the middle region of human DCAF4L1. Synthetic peptide located within the following region: HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL |
|---|
| Other Names | WDR21B, DDB1 and CUL4 associated factor 4-like 1 |
|---|
| Gene, Accession # | DCAF4L1, Accession: NM_001029955 |
|---|
| Catalog # | TA334962 |
|---|
| Price | |
|---|
| Order / More Info | DCAF4L1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|