| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S1P1/EDG-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S1P1/EDG-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S1P1/EDG-1. This antibody reacts with human. The S1P1/EDG-1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human S1P1/EDG-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT |
|---|
| Other Names | CD363, CD363 antigen, CHEDG1, D1S3362, EDG-1, EDG1edg-1, Endothelial differentiation G-protein coupled receptor 1, endothelial differentiation, sphingolipid G-protein-coupled receptor, 1, FLJ58121, S1P receptor 1, S1P receptor Edg-1, s1p1, S1P1ECGF1, sphingosine 1-phosphate receptor 1, sphingosine 1-phosphate receptor EDG1, Sphingosine 1-phosphate receptor Edg-1, sphingosine-1-phosphate receptor 1 |
|---|
| Gene, Accession # | S1PR1, Gene ID: 1901 |
|---|
| Catalog # | NBP2-58024 |
|---|
| Price | |
|---|
| Order / More Info | S1P1/EDG-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|