| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSD17B8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSD17B8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B8. This antibody reacts with human. The HSD17B8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HSD17B8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY |
|---|
| Other Names | D6S2245EdJ1033B10.9, EC 1.1.1.-, EC 1.1.1.62, EC 1.1.1.63,17-beta-HSD 8, estrogen 17-oxidoreductase, FABGLestradiol 17-beta-dehydrogenase 8, H2-KE6, HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli), hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase, ke-6, KE6, Ke-6,17-beta-hydroxysteroid dehydrogenase 8, Protein Ke6, Really interesting new gene 2 protein, RING2FABG, SDR30C1, short chain dehydrogenase/reductase family 30C, member 1, Testosterone 17-beta-dehydrogenase 8 |
|---|
| Gene, Accession # | HSD17B8, Gene ID: 7923 |
|---|
| Catalog # | NBP1-84309 |
|---|
| Price | |
|---|
| Order / More Info | HSD17B8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|