| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSD17B7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSD17B7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B7. This antibody reacts with human. The HSD17B7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HSD17B7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMD LDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC |
|---|
| Other Names | 17 beta-hydroxysteroid dehydrogenase type VII, 17-beta-hydroxysteroid dehydrogenase 7, 3-keto-steroid reductase, EC 1.1.1.270, EC 1.1.1.62, Estradiol 17-beta-dehydrogenase 7, hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase, MGC12523, MGC75018,17-beta-HSD 7, PRAP, SDR37C1, short chain dehydrogenase/reductase family 37C, member 1 |
|---|
| Gene, Accession # | HSD17B7, Gene ID: 51478 |
|---|
| Catalog # | NBP2-14102 |
|---|
| Price | |
|---|
| Order / More Info | HSD17B7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|