| 产品详情 |
| Edit |   |
| Antigenic Specificity | HSD17B6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HSD17B6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B6. This antibody reacts with human. The HSD17B6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HSD17B6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL |
| Other Names | 17-beta-HSD 6, 17-beta-HSD6, 17-beta-hydroxysteroid dehydrogenase type 6, 3(alpha->beta)-hydroxysteroid epimerase, 3-alpha->beta-HSE, EC 1.1.1, EC 1.1.1.105, EC 1.1.1.62, EC 1.1.1.63, HSE3-hydroxysteroid epimerase, hydroxysteroid (17-beta) dehydrogenase 6, hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse), NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase, Oxidative 3-alpha hydroxysteroid dehydrogenase, oxidative 3-alpha-hydroxysteroid-dehydrogenase, oxidoreductase, retinol dehydrogenase, RODH3(alpha->beta)-hydroxysteroid epimerasel, SDR9C6, short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase |
| Gene, Accession # | HSD17B6, Gene ID: 8630 |
| Catalog # | NBP2-32431 |
| Price | |
| Order / More Info | HSD17B6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29152775 |
| 产品资料 |
|
|