| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PKD2L1 |
|---|
| Clone | 4F9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PKD2L1 Antibody (4F9) from Novus Biologicals is a mouse monoclonal antibody to PKD2L1. This antibody reacts with human, rat. The PKD2L1 Antibody (4F9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PKD2L1 (NP_057196.2 173 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL |
|---|
| Other Names | PCL, PKD2Lpolycystin-L, PKDLpolycystin-L1, polycystic kidney disease 2-like 1, polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog, polycystin-2L1, Polycystin-L, Polycystin-L1, transient receptor potential cation channel, subfamily P, member 3, TRPP3 |
|---|
| Gene, Accession # | PKD2L1, Gene ID: 9033, Accession: NP_057196, SwissProt: NP_057196 |
|---|
| Catalog # | H00009033-M01 |
|---|
| Price | |
|---|
| Order / More Info | PKD2L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25820328 |
|---|
| 产品资料 |
|
|