| 产品详情 |
| Edit |   |
| Antigenic Specificity | HRAS like suppressor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HRAS like suppressor Antibody from Novus Biologicals is a rabbit polyclonal antibody to HRAS like suppressor. This antibody reacts with human. The HRAS like suppressor Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HRAS like suppressor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKY DETYPPLPVEEIIKRSEFVIGQEVAYNLLVNN |
| Other Names | A-C1, HRAS-like suppressor, HRASLS1, H-REV107, H-REV107 protein-related protein, HSD28, phospholipase A |
| Gene, Accession # | HRASLS, Gene ID: 57110 |
| Catalog # | NBP2-14101 |
| Price | |
| Order / More Info | HRAS like suppressor Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|