| Edit |   |
|---|
| Antigenic Specificity | OST4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat, human, mouse, zebrafish, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-OST4 Antibody |
|---|
| Immunogen | The immunogen for anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4. Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE |
|---|
| Other Names | oligosaccharyltransferase 4 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | OST4, Accession: NM_001134693 |
|---|
| Catalog # | TA338306 |
|---|
| Price | |
|---|
| Order / More Info | OST4 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|