| Edit |   |
|---|
| Antigenic Specificity | ETV3L - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ETV3L Antibody - middle region |
|---|
| Immunogen | The immunogen for Anti-Etv3l antibody is: synthetic peptide directed towards the middle region of Rat Etv3l. Synthetic peptide located within the following region: HVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKR |
|---|
| Other Names | ets variant 3-like |
|---|
| Gene, Accession # | ETV3L, Accession: NM_001004341 |
|---|
| Catalog # | TA344516 |
|---|
| Price | |
|---|
| Order / More Info | ETV3L - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|