| Edit |   |
|---|
| Antigenic Specificity | SNAP25 Interacting Protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNAP25 Interacting Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNAP25 Interacting Protein. This antibody reacts with human. The SNAP25 Interacting Protein Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SNAP25 Interacting Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR |
|---|
| Other Names | KIAA1684P140, p130Cas-associated protein, p140CapSNAP25-interacting protein, SNIPSNAP-25-interacting protein, SRC kinase signaling inhibitor 1 |
|---|
| Gene, Accession # | SRCIN1, Gene ID: 80725 |
|---|
| Catalog # | NBP1-92412 |
|---|
| Price | |
|---|
| Order / More Info | SNAP25 Interacting Protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|