| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Binding Domain Containing 3 (Acbd3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. |
|---|
| Immunogen | ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL |
|---|
| Other Names | fa20g08|si:dkey-267p15.1|wu:fa20g08|zgc:66303|cb366|GOLPH1|sb:cb366|wu:fa04b12|wu:fd14b03|wu:fi29h06|ACBD3|acbd3|MGC122176|GCP60|GOCAP1|PAP7|T22A6.60|T22A6_60|acyl-CoA-binding domain 3|60kDa|8430407O11Rik|D1Ertd10e|Gocap1|Pap7 |
|---|
| Gene, Accession # | Gene ID: 64746 |
|---|
| Catalog # | ABIN632589 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Binding Domain Containing 3 (Acbd3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|