Edit |   |
Antigenic Specificity | TRIM34 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-TRIM34 Antibody |
Immunogen | The immunogen for anti-TRIM34 antibody: synthetic peptide directed towards the N terminal of human TRIM34. Synthetic peptide located within the following region: CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV |
Other Names | IFP1, RNF21, tripartite motif containing 34 |
Gene, Accession # | TRI34, Accession: NM_130390 |
Catalog # | TA345334 |
Price | |
Order / More Info | TRIM34 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |