| Edit |   |
|---|
| Antigenic Specificity | PDE1C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE1C. This antibody reacts with human. The PDE1C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C, calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR. |
|---|
| Other Names | calmodulin-dependent (70kD), EC 3.1.4, phosphodiesterase 1C, calmodulin-dependent 70kDa |
|---|
| Gene, Accession # | PDE1C, Gene ID: 5137, Accession: Q8TAE4, SwissProt: Q8TAE4 |
|---|
| Catalog # | NBP1-52956 |
|---|
| Price | |
|---|
| Order / More Info | PDE1C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|