| Edit |   |
| Antigenic Specificity | PDE1C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDE1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE1C. This antibody reacts with human. The PDE1C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDE1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTE |
| Other Names | calmodulin-dependent (70kD), EC 3.1.4, phosphodiesterase 1C, calmodulin-dependent 70kDa |
| Gene, Accession # | PDE1C, Gene ID: 5137 |
| Catalog # | NBP2-48555 |
| Price | |
| Order / More Info | PDE1C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |