| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE6 beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE6 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE6 beta. This antibody reacts with human. The PDE6 beta Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDE6 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRDEIQLILPTRARLGKEPADCDEDELGEILKEELPGPTTFDIYEFHFSDL |
|---|
| Other Names | CSNB3, EC 3.1.4, EC 3.1.4.35, GMP-PDE beta, PDEBrod cGMP-phosphodiesterase beta-subunit, phosphodiesterase 6B, cGMP-specific, rod, beta, rd1, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta, RP40CSNBAD2 |
|---|
| Gene, Accession # | PDE6B, Gene ID: 5158 |
|---|
| Catalog # | NBP2-58654 |
|---|
| Price | |
|---|
| Order / More Info | PDE6 beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|