| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE8B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE8B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE8B. This antibody reacts with human. The PDE8B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PDE8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD |
|---|
| Other Names | 3'-5' cyclic nucleotide phosphodiesterase 8B, ADSD, Cell proliferation-inducing gene 22 protein, EC 3.1.4.17, FLJ11212, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B, hsPDE8B, phosphodiesterase 8B, PPNAD3 |
|---|
| Gene, Accession # | PDE8B, Gene ID: 8622 |
|---|
| Catalog # | NBP2-58096 |
|---|
| Price | |
|---|
| Order / More Info | PDE8B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|