| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FCRN/FCGRT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FCRN/FCGRT Antibody from Novus Biologicals is a rabbit polyclonal antibody to FCRN/FCGRT. This antibody reacts with human. The FCRN/FCGRT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to FCGRT(Fc fragment of IgG, receptor, transporter, alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE. |
|---|
| Other Names | alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig |
|---|
| Gene, Accession # | FCGRT, Gene ID: 2217, Accession: P55899, SwissProt: P55899 |
|---|
| Catalog # | NBP1-59061 |
|---|
| Price | |
|---|
| Order / More Info | FCRN/FCGRT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|