| Edit |   |
| Antigenic Specificity | FCRL6/FcRH6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FCRL6/FcRH6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FCRL6/FcRH6. This antibody reacts with human. The FCRL6/FcRH6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human FCRL6. Peptide sequence LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ. |
| Other Names | Fc receptor-like 6, FLJ16056 |
| Gene, Accession # | FCRL6, Gene ID: 343413, Accession: NP_001004310, SwissProt: NP_001004310 |
| Catalog # | NBP1-91578 |
| Price | |
| Order / More Info | FCRL6/FcRH6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |