| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MLLT1 |
|---|
| Clone | 3H2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IF. IHC-P usage reported in scientific literature (PMID: 25481096). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MLLT1 Antibody (3H2) from Novus Biologicals is a mouse monoclonal antibody to MLLT1. This antibody reacts with human, mouse. The MLLT1 Antibody (3H2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MLLT1 (NP_005925 472 a.a. - 558 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA |
|---|
| Other Names | ENLENL/MLL fusion, LTG19MLLT1/MLL fusion, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 1, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 1, protein ENL, YEATS domain-containing protein 1, YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 1 |
|---|
| Gene, Accession # | MLLT1, Gene ID: 4298, Accession: NP_005925, SwissProt: NP_005925 |
|---|
| Catalog # | H00004298-M01 |
|---|
| Price | |
|---|
| Order / More Info | MLLT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25481096 |
|---|
| 产品资料 |
|
|